site stats

Patellin-3

WebGene ID: 843547, updated on 5-Jan-2024 Summary Other designations Sec14p-like phosphatidylinositol transfer family protein GeneRIFs: Gene References Into Functions the interaction between Alfalfa mosaic virus (AMV) MP and Arabidopsis Patellin 3 (atPATL3) and Patellin 6 (atPATL6), is reported. WebOct 25, 2005 · Function Carrier protein that may be involved in membrane-trafficking events associated with cell plate formation during cytokinesis. Binds to some hydrophobic molecules such as phosphoinositides and promotes their transfer between the different cellular sites ( By similarity ). By similarity Miscellaneous 'Patella' means 'small plate' in …

PhytoMine: GeneFlankingRegion Cagra.0691s0003 2.0kb …

WebMay 12, 2016 · The patellin proteins are Sec14-like proteins characterized by a variable N-terminal domain, a lipid-binding domain and a C-terminal GOLD domain (Peterman et al. … WebApr 20, 2008 · The patellamides ( 3, 4, 5, 6, 7, 8) are biosynthesized through a unique ribosomal route 2 with some similarity to microcin pathways ( Fig. 1) 8. The products' … redpath centre for autism https://gs9travelagent.com

UniProt

WebDec 19, 2013 · Abstract Peanut ( Arachis hypogaea L) is one of the widely cultivated and leading oilseed crops of the world and its yields are greatly affected by various biotic and abiotic stresses. Arachis diogoi, a wild relative of peanut, is an important source of genes for resistance against various stresses that affect peanut. Webpatellin-3. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. LOC105130630 patellin-3 [ (Euphrates poplar)] Gene ID: … WebJun 7, 2024 · Patellin-3-like, clathrin heavy chain, heat shock proteins, 14-3-3 protein, glyceraldehyde-3-phosphate dehydrogenase and fructose-bisphosphate aldolase 6 were highly expressed in all citrus vesicle fractions. The presence of membrane channel aquaporin on the other hand characteristic of the nanovesicle fractions. redpath client tax collaboration portal

105110573 - Gene ResultLOC105110573 patellin-3 [ (Euphrates …

Category:Protein biocargo of citrus fruit-derived vesicles reveals ... - bioRxiv

Tags:Patellin-3

Patellin-3

(PDF) The exocyst complex in plants Marek Eliáš - Academia.edu

WebOct 25, 2005 · Function. Carrier protein that may be involved in membrane-trafficking events associated with cell plate formation during cytokinesis. Binds to some hydrophobic … WebAug 16, 2024 · In Arabidopsis, PATL3-GFP colocalized with EXO70A1 predominantly at the cell membrane, and PATL3 localization was insensitive to BFA and TryA23. Remarkably, …

Patellin-3

Did you know?

WebApr 19, 2024 · In this study, we report that Patellin1 (PATL1), a membrane trafficking-related protein, modulates salt tolerance in Arabidopsis. The T-DNA insertion mutant of PATL1 ( patl1) with an elevated PATL1 transcription level displays a salt-sensitive phenotype. WebJan 8, 2024 · The macronutrient potassium is essential to plant growth, development and stress response. Alligator weed (Alternanthera philoxeroides) has a high tolerance to potassium deficiency (LK) stress. The...

Webpatellin 2; purple, patellin 3. (B) Dorsal root ganglion assay using cultivated mouse neurons. Each trace represents the response of a single neuron in culture. KCl (arrows on the x axis) is added to the culture and removed, leading to depolarization and Ca2+ entry into the cell, measured using the fluorescence ratio of Ca2+-responsive Fura-2 ... WebMar 1, 2024 · The patellin protein family in plants Arabidopsis patellin proteins (PATL, derived from a Latin word “ patella ” which means small plate) are typical Sec14-GOLD …

Webpatellin-3. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. LOC105110573 patellin-3 [ (Euphrates poplar)] Gene ID: … WebPatellin 3 Cite Download Contents 1 Structures 2 Biologic Description 3 Names and Identifiers 4 Chemical and Physical Properties 5 Related Records 6 Literature 7 Patents …

WebFlank Size: 2.0kb: Direction: upstream: Gene Included?: false: Organism Name: Capsella grandiflora

WebHigh expression levels of patellin-3-like, clathrin heavy chain, heat shock proteins, 14-3-3 protein, glyceraldehyde-3-phosphate dehydrogenase and fructose-bisphosphate aldolase 6 were measured in all samples while aquaporin was … richfield senior centerWebApr 1, 2014 · Patellins 3 and 6, two members of the Plant Patellin family, interact with the movement protein of Alfalfa mosaic virus and interfere with viral movement Authors: Ana … redpath car sales edinburghWebJan 29, 2024 · PATLs are plasma membrane-associated proteins accumulated in Arabidopsis embryos, primary roots, lateral root primordia and developing stomata. Higher order patl mutants display reduced … redpath companyWebMay 12, 2016 · The patellin proteins are Sec14-like proteins characterized by a variable N-terminal domain, a lipid-binding domain and a C-terminal GOLD domain (Peterman et al. 2004 ). The GOLD domain participates in protein–protein interactions and is present in a number Golgi function and vesicle traffic related proteins (Anantharaman and Aravind … redpath cinnamon sugarWebgenome browser: aa seq: 557 aa aa seq db search maeevpktsttqeevvvsdvapaekpdttnvvvvplekdaqpqqneeetspekkkenvte tetesevskpsgdgnvpesgsfkeestivsdlpetekkalqelkqliqealnkhefsavp redpath christmasWebArabidopsis EXO70A1 recruits Patellin3 to the cell membrane independent of its role as an exocyst subunit The exocyst is a well-known complex which tethers vesicles at the cell … redpath clinicWebSep 10, 2015 · This pathway starts with a condensation of malonyl-CoA and 4-coumaroyl CoA, and is catalysed by multiple enzymes including chalcone synthase (CHS), chalcone isomerase (CHI), flavanone 3-hydroxylase (F3H), flavonoid 3′-hydroxylase (F3′H), flavonoid 3′5′-hydroxylase (F3′5′H), dihydroflavonol 4-reductase (DFR), and UDPG-flavonoid … redpath close leicester